PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0225s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 666aa    MW: 74410.7 Da    PI: 6.1858
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0225s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.71.9e-22128228198
                             EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                             f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD +
  SapurV1A.0225s0120.1.p 128 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAF 212
                             99****************************964333..4459********************************************* PP

                             EEEE-SSSEE..EEEEE- CS
                      B3  81 vFkldgrsefelvvkvfr 98 
                             +F   + +++el+v+v+r
  SapurV1A.0225s0120.1.p 213 IFL--RGENGELCVGVRR 228
                             ***..449999*****97 PP

2Auxin_resp105.94.8e-35254336183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha++t++ F+v+Y+Pr+s+seF+v+++k+++  + k+svGmRfkm+fe+e+++err+sGt+vg+ d  ++ W +S WrsLk
  SapurV1A.0225s0120.1.p 254 ASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEVRNYKLSVGMRFKMRFEGEEVPERRFSGTIVGIGDNISSGWADSDWRSLK 336
                             789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.5E-43119257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-40126243IPR015300DNA-binding pseudobarrel domain
CDDcd100173.68E-21126228No hitNo description
SMARTSM010199.5E-22128230IPR003340B3 DNA binding domain
PfamPF023622.3E-20128228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.209128230IPR003340B3 DNA binding domain
PfamPF065075.3E-33254336IPR010525Auxin response factor
PfamPF023091.0E-6532575IPR033389AUX/IAA domain
PROSITE profilePS5174526.411539632IPR000270PB1 domain
SuperFamilySSF542774.32E-9542616No hitNo description
PfamPF023095.1E-6583629IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MAFAAMNNTS GGNPNAGGCN DALYKELWHA CAGPLVTLPR EGELVYYFPQ GHMEQLEASM  60
HQGMEQQMPS FNLPSKILCK VVNVQRRAEP ETDEVYAQIT LFPEPDQSEV TRRDPPPPEP  120
ERCTIHSFCK TLTASDTSTH GGFSVLRRHA DDCLPPLDMS QQPPWQELVA TDLHGNEWHF  180
RHIFRGQPRR HLLTTGWSVF VSSKKLVAGD AFIFLRGENG ELCVGVRRLM RQQMSMPSSV  240
ISSQSMHLGV LATASHAIAT GTLFSVFYKP RTSRSEFIVS LNKYLEVRNY KLSVGMRFKM  300
RFEGEEVPER RFSGTIVGIG DNISSGWADS DWRSLKVQWD EPSSIMRPER VSHWELEPLV  360
ATTPLNSQPV QRNKRPRPSV LPSPTTDITS LGKWKSVAES SALSYGDSQH GRDLYPSIGF  420
STIAKANSLG FHGNSQVASV SHNSMYRHNR VESVTDSFAS VVNKDYRERR QGTGIGYRLF  480
GIQLVDNSNT EETSPINAMS GTMVNDHPVL SLEAESDQHS EPEKSCLRSP QELQSRQIRS  540
CTKVHMQGVA VGRAVDLTQF EGYEDLMRKL EEMFDIEGEL SGSTKKWEVV YTDNEDDMMK  600
VGDDPWNEFC SMVKKIFIYT SEEVKRLSPK IKLLADEEVK GVGNNADADA AVNTEDRSST  660
IGPGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B0.053592355Auxin response factor 1
4ldw_A0.053592355Auxin response factor 1
4ldv_A0.053592355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1373377KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM1130350.0KM113035.1 Populus davidiana x Populus alba var. pyramidalis auxin response factor 1 family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385086.10.0hypothetical protein POPTR_0004s23770g
RefseqXP_006385087.10.0auxin response factor 1 family protein
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLB9N0I30.0B9N0I3_POPTR; Auxin response factor
STRINGPOPTR_0003s00890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68022638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1